PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_7FB19CC37.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 475aa    MW: 53195.3 Da    PI: 8.4567
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_7FB19CC37.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.34.5e-27111198190
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn YA++vGF vr+s+  ++++n  it+rtfvCs+eg+re++k + ++++ +r+etr+gC a+++++++ +gk+++t+++ +HnH+
  Traes_2DS_7FB19CC37.1 111 EFYNIYAEKVGFFVRRSTLWTTSKNI-ITRRTFVCSREGFREKKKGA-KESKCPRPETRIGCPASMTIRLTPNGKYRLTEFVPNHNHQ 196
                            6********************97766.****************9999.9999************************************ PP

                   FAR1  89 la 90 
                            la
  Traes_2DS_7FB19CC37.1 197 LA 198
                            97 PP

2FAR183.63.1e-26240326189
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY+ YA ++GF+vr+++++ +  ++ it+r fvCskeg+re+++ + ++ +++r+etrtgC a++++++ ++gk++vt++++ HnH 
  Traes_2DS_7FB19CC37.1 240 EFYSMYAGKIGFNVRRASMTVN-AENVITRRMFVCSKEGFREKKRGA-NRVKKPRPETRTGCPACMVIRLASNGKYNVTEFVTFHNHG 325
                            6****************99998.5566****************9998.9**************************************9 PP

                   FAR1  89 l 89 
                            l
  Traes_2DS_7FB19CC37.1 326 L 326
                            8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-24111198IPR004330FAR1 DNA binding domain
PfamPF031012.9E-22240326IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MSSNSGGGAK EKGPRIATPL VPPPLVQNSM PTASDGPTTD LRLAQQSWPG HVVLRPCTSW  60
PPHVNPAYPQ QNGEAVADVV AADVLPVINS CNEKMLPEVN MLFDDENDAY EFYNIYAEKV  120
GFFVRRSTLW TTSKNIITRR TFVCSREGFR EKKKGAKESK CPRPETRIGC PASMTIRLTP  180
NGKYRLTEFV PNHNHQLATA STIHMLKAKK IRRKARAVRE NLVDDTVVTP EFENEDEAYE  240
FYSMYAGKIG FNVRRASMTV NAENVITRRM FVCSKEGFRE KKRGANRVKK PRPETRTGCP  300
ACMVIRLASN GKYNVTEFVT FHNHGLGAAA ASDLVMTSLT AGSYQDCGVD LYDEALDDCY  360
GKQNLIKDDA TSNCLEGRSW KRYKCKVPHY GDVGATLEYL QKMQHDNPSF FYAVKSDEDG  420
NLTNFLWADS KSIMDFTHFG DVVCLDSGYE VQGYGRPIAL FTGLNHHRQT VIFGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3766160.0AK376616.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3129B22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753080.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5C6A80.0W5C6A8_WHEAT; Uncharacterized protein
STRINGMLOC_76708.60.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-42FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]